--- type: "firecrawl-provider" description: "The Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution." use_when: "The Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution.\n\nThe Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution." categories: "Health" capabilities: 3 credits_per_call: 5 --- # Human Protein Atlas on Firecrawl Alexandria The Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution. - Categories: Health - Category index: [Health category](https://firecrawl.dev/alexandria/agents/categories/health) - Provider key: `proteinatlas-org` - Access: Firecrawl credits - Cost: 5 credits per call ## More - [Human guide](https://firecrawl.dev/app/alexandria/proteinatlas-org) - [OpenAPI spec](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/openapi.json) ## Capabilities - [Protein](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/proteins/protein): One human gene's protein in the Human Protein Atlas, by gene symbol or synonym, Ensembl gene ID, UniProt accession or proteinatlas.org URL: every subcellular location with its own reliability grade, main or additional status and GO ID, the gene-level reliability, what Enhanced grades rest on (siRNA, independent antibodies), extracellular location, single-cell variation and cell cycle dependency; RNA tissue and single cell type specificity with the tissues and cell types that express it most (nTPM, nCPM); protein evidence (HPA, UniProt, neXtProt), protein classes, chromosome position, secretome location and function; and the IDs of HPA's antibodies for it. A symbol or accession shared by several genes is invalid_input listing them; an unknown gene is not_found. - [Search](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/proteins/search): Search human genes in the Human Protein Atlas by subcellular location (one of HPA's 49 terms, with a minimum reliability and optionally main locations only), by RNA tissue or single cell type specificity (enriched, group enriched or enhanced in a named tissue or cell type), by free text or HPA search syntax, or any combination (ANDed). A location search ranks by that location's own reliability, then main before additional; a tissue or cell type search ranks by specificity, then expression there; a text search keeps HPA's order. Each result has the gene, Ensembl and UniProt IDs, the matched location with its reliability and GO ID, all main and additional locations, and the requested RNA specificity. HPA returns whole result sets, so total_count is exact and next_offset pages on. An empty result is a valid empty page; an unknown tissue or cell type name is invalid_input. - [Antibodies](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/antibodies/antibodies): The antibodies the Human Protein Atlas used for one gene, by gene symbol or synonym, Ensembl gene ID, UniProt accession or proteinatlas.org URL: antibody ID, providers with product links, product name, host species, clonality, the HPA release it first appeared in, publication count, antigen sequence, and the validation grade for each application (immunocytochemistry, immunohistochemistry, western blot, protein array) with the method behind Enhanced (genetic, orthogonal, independent, recombinant). A gene without antibodies has an empty list; an unknown gene is not_found. ## 1. Choose this provider when The Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution. The Human Protein Atlas (KTH, Uppsala University and SciLifeLab, Sweden), CC BY 4.0: for every human protein-coding gene, where the protein sits in the cell from antibody immunofluorescence, with a reliability grade (Enhanced, Supported, Approved, Uncertain) and GO ID per location, the evidence behind Enhanced grades and single-cell variation; RNA tissue and single cell type specificity with the tissues and cells that express it most; protein evidence, protein classes and secretome annotation; and the antibodies HPA used, with providers, product names, clonality and per-application validation. Search genes by location and reliability, by tissue or cell type enrichment, or by free text and HPA search syntax. Uses HPA's keyless search API and gene pages; every result carries the release, licence and attribution. ## 2. Minimal request Call `POST https://api.firecrawl.dev/v2/scrape` with `{ alexandria: { provider, capability, options } }`. For a batch, send `{ alexandria: [...] }` with up to 10 calls. ```json { "provider": "proteinatlas-org", "capability": "proteins/protein", "options": { "gene": "TP53" } } ``` ## 3. Add provider options Use only the options needed for the task: - `gene` (string): Gene symbol or synonym (TP53, p53, FAM46C), Ensembl gene ID (ENSG00000141510; a .version is ignored) or UniProt accession (P04637). Pass this or url. Example: `` - `url` (string): A proteinatlas.org gene page URL, e.g. https://www.proteinatlas.org/ENSG00000141510-TP53/subcellular. Example: `` ## 4. Request through your preferred interface ### JavaScript ```javascript const result = await firecrawl.scrape({ alexandria: { provider: "proteinatlas-org", capability: "proteins/protein", options: { gene: "TP53", }, }, }); ``` ### Python ```python result = firecrawl.scrape_alexandria({ "provider": "proteinatlas-org", "capability": "proteins/protein", "options": { "gene": "TP53" } }) ``` ### cURL ```sh curl https://api.firecrawl.dev/v2/scrape \ -H "Authorization: Bearer $FIRECRAWL_API_KEY" \ -H "Content-Type: application/json" \ -d '{ "alexandria": { "provider": "proteinatlas-org", "capability": "proteins/protein", "options": { "gene": "TP53" } } }' ``` ### CLI ```sh firecrawl scrape 'proteinatlas-org/proteins/protein' \ --options '{"gene":"TP53"}' ``` ### MCP Call the FCX MCP retrieve tool with this object: ```json { "provider": "proteinatlas-org", "capability": "proteins/protein", "options": { "gene": "TP53" } } ``` Ask for only the returned fields needed by the task. ## 5. Full request shape ```json { "provider": "proteinatlas-org", "capability": "proteins/protein", "options": { "gene": "TP53" } } ``` ## 6. Response data The response includes `success`, `provider`, `capability`, `creditsCost` and `data`. This example shows the provider payload in `data`: ```json { "antibody_ids": [ "CAB002973", "CAB039238", "CAB039239", "HPA051244", "HPA063532", "CAB072876" ], "chromosome": "17", "description": "Tumor protein p53", "ensembl_gene_id": "ENSG00000141510", "gene": "TP53", "gene_synonyms": [ "LFS1", "p53" ], "license": { "attribution": "Human Protein Atlas (proteinatlas.org) version 25.1, licensed under CC BY 4.0. Data available from https://v25.proteinatlas.org/ENSG00000141510. Cite Uhlén M et al., Tissue-based map of the human proteome, Science 2015 (doi:10.1126/science.1260419); Thul PJ et al., A subcellular map of the human proteome, Science 2017 (doi:10.1126/science.aal3321); Karlsson M et al., A single-cell type transcriptomics map of human tissues, Sci Adv 2021 (doi:10.1126/sciadv.abh2169).", "name": "CC BY 4.0", "url": "https://creativecommons.org/licenses/by/4.0/" }, "matched_on": "gene_name", "observed_at_ms": 1792530413379, "position": "7661779-7687538", "protein_classes": [ "Cancer-related genes", "Disease related genes", "Human disease related genes", "Plasma proteins", "Potential drug targets", "Predicted intracellular proteins", "Transcription factors", "Transporters" ], "protein_evidence": { "hpa": "Evidence at protein level", "nextprot": "Evidence at protein level", "summary": "Evidence at protein level", "uniprot": "Evidence at protein level" }, "release": "25.1", "rna_single_cell_type": { "distribution": "Detected in many", "elevated": [], "specificity": "Low cell type specificity", "specificity_score": null }, "rna_tissue": { "distribution": "Detected in all", "elevated": [], "specificity": "Low tissue specificity", "specificity_score": null }, "secretome": null, "source_url": "https://v25.proteinatlas.org/ENSG00000141510", "subcellular": { "cell_cycle_dependency": "Variation in protein expression correlates with the cell-cycle. Transcript variation is not correlated to the cell cycle.", "enhanced_by": [ "siRNA mediated gene silencing" ], "extracellular": null, "locations": [ { "go_id": "GO:0005654", "name": "Nucleoplasm", "reliability": "Enhanced", "status": "main" }, { "go_id": "GO:0043231", "name": "Vesicles", "reliability": "Approved", "status": "additional" }, { "go_id": "GO:0005829", "name": "Cytosol", "reliability": "Supported", "status": "additional" } ], "reliability": "Enhanced", "single_cell_variation": "Single-cell variation in protein expression observed.", "source_url": "https://v25.proteinatlas.org/ENSG00000141510/subcellular" }, "uniprot_accessions": [ "P04637" ] } ``` ## API reference-derived contract The following capability contract is generated from the same normalized Alexandria API reference exposed in the API spec. ### Protein - Capability: `proteins/protein` - Description: One human gene's protein in the Human Protein Atlas, by gene symbol or synonym, Ensembl gene ID, UniProt accession or proteinatlas.org URL: every subcellular location with its own reliability grade, main or additional status and GO ID, the gene-level reliability, what Enhanced grades rest on (siRNA, independent antibodies), extracellular location, single-cell variation and cell cycle dependency; RNA tissue and single cell type specificity with the tissues and cell types that express it most (nTPM, nCPM); protein evidence (HPA, UniProt, neXtProt), protein classes, chromosome position, secretome location and function; and the IDs of HPA's antibodies for it. A symbol or accession shared by several genes is invalid_input listing them; an unknown gene is not_found. - Instructions: Where a protein is in the cell and how sure HPA is of each location, which tissues and cell types express it, or whether it is secreted. Take a gene from search or from the user; then antibodies for reagent details. - Cost: 5 credits per call - Capability file: [Protein](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/proteins/protein) Accepted options: - `gene` (string): Gene symbol or synonym (TP53, p53, FAM46C), Ensembl gene ID (ENSG00000141510; a .version is ignored) or UniProt accession (P04637). Pass this or url. Example: `` - `url` (string): A proteinatlas.org gene page URL, e.g. https://www.proteinatlas.org/ENSG00000141510-TP53/subcellular. Example: `` Response schema example: ```json { "antibody_ids": [ "CAB002973", "CAB039238", "CAB039239", "HPA051244", "HPA063532", "CAB072876" ], "chromosome": "17", "description": "Tumor protein p53", "ensembl_gene_id": "ENSG00000141510", "gene": "TP53", "gene_synonyms": [ "LFS1", "p53" ], "license": { "attribution": "Human Protein Atlas (proteinatlas.org) version 25.1, licensed under CC BY 4.0. Data available from https://v25.proteinatlas.org/ENSG00000141510. Cite Uhlén M et al., Tissue-based map of the human proteome, Science 2015 (doi:10.1126/science.1260419); Thul PJ et al., A subcellular map of the human proteome, Science 2017 (doi:10.1126/science.aal3321); Karlsson M et al., A single-cell type transcriptomics map of human tissues, Sci Adv 2021 (doi:10.1126/sciadv.abh2169).", "name": "CC BY 4.0", "url": "https://creativecommons.org/licenses/by/4.0/" }, "matched_on": "gene_name", "observed_at_ms": 1792530413379, "position": "7661779-7687538", "protein_classes": [ "Cancer-related genes", "Disease related genes", "Human disease related genes", "Plasma proteins", "Potential drug targets", "Predicted intracellular proteins", "Transcription factors", "Transporters" ], "protein_evidence": { "hpa": "Evidence at protein level", "nextprot": "Evidence at protein level", "summary": "Evidence at protein level", "uniprot": "Evidence at protein level" }, "release": "25.1", "rna_single_cell_type": { "distribution": "Detected in many", "elevated": [], "specificity": "Low cell type specificity", "specificity_score": null }, "rna_tissue": { "distribution": "Detected in all", "elevated": [], "specificity": "Low tissue specificity", "specificity_score": null }, "secretome": null, "source_url": "https://v25.proteinatlas.org/ENSG00000141510", "subcellular": { "cell_cycle_dependency": "Variation in protein expression correlates with the cell-cycle. Transcript variation is not correlated to the cell cycle.", "enhanced_by": [ "siRNA mediated gene silencing" ], "extracellular": null, "locations": [ { "go_id": "GO:0005654", "name": "Nucleoplasm", "reliability": "Enhanced", "status": "main" }, { "go_id": "GO:0043231", "name": "Vesicles", "reliability": "Approved", "status": "additional" }, { "go_id": "GO:0005829", "name": "Cytosol", "reliability": "Supported", "status": "additional" } ], "reliability": "Enhanced", "single_cell_variation": "Single-cell variation in protein expression observed.", "source_url": "https://v25.proteinatlas.org/ENSG00000141510/subcellular" }, "uniprot_accessions": [ "P04637" ] } ``` ### Search - Capability: `proteins/search` - Description: Search human genes in the Human Protein Atlas by subcellular location (one of HPA's 49 terms, with a minimum reliability and optionally main locations only), by RNA tissue or single cell type specificity (enriched, group enriched or enhanced in a named tissue or cell type), by free text or HPA search syntax, or any combination (ANDed). A location search ranks by that location's own reliability, then main before additional; a tissue or cell type search ranks by specificity, then expression there; a text search keeps HPA's order. Each result has the gene, Ensembl and UniProt IDs, the matched location with its reliability and GO ID, all main and additional locations, and the requested RNA specificity. HPA returns whole result sets, so total_count is exact and next_offset pages on. An empty result is a valid empty page; an unknown tissue or cell type name is invalid_input. - Instructions: Find proteins in a compartment (location Nucleoli, min_reliability Supported), genes enriched in a tissue (tissue liver) or cell type (cell_type hepatocytes), or both at once; then call protein for one gene's full localization and expression, or antibodies for its reagents. - Cost: 5 credits per call - Capability file: [Search](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/proteins/search) Accepted options: - `cell_type` (string): Single cell type name as HPA writes it, case-insensitive and usually plural: hepatocytes, T-cells, cardiomyocytes. Example: `` - `limit` (number): limit Example: `20` - `location` (string): Subcellular location term exactly as HPA names it. Example: `Acrosome` - `main_location_only` (boolean): Only genes with location as a main location. Example: `false` - `min_reliability` (string): Lowest reliability of location to include; default Uncertain (all). Supported keeps Enhanced and Supported. Example: `Enhanced` - `offset` (number): Results to skip; pass the previous page's next_offset. Example: `0` - `query` (string): Free text (kinase, insulin receptor) or HPA search syntax (protein_class:Transcription factors), ANDed with the other filters. Field values HPA does not know match nothing rather than failing. Example: `` - `specificity` (string[]): RNA specificity categories for tissue or cell_type; default all three. enriched: at least 4x every other tissue or cell type; group_enriched: 4x in a small group; enhanced: 4x the mean. Example: `[]` - `tissue` (string): Tissue name as HPA writes it, case-insensitive: liver, skeletal muscle, cerebral cortex, pancreas. Example: `` Response schema example: ```json { "hpa_query": "subcell_location:Rods & Rings", "license": { "attribution": "Human Protein Atlas (proteinatlas.org) version 25.1, licensed under CC BY 4.0. Data available from https://v25.proteinatlas.org/search/subcell_location:Rods%20%26%20Rings. Cite Uhlén M et al., Tissue-based map of the human proteome, Science 2015 (doi:10.1126/science.1260419); Thul PJ et al., A subcellular map of the human proteome, Science 2017 (doi:10.1126/science.aal3321).", "name": "CC BY 4.0", "url": "https://creativecommons.org/licenses/by/4.0/" }, "limit": 20, "next_offset": null, "observed_at_ms": 1792530428739, "offset": 0, "release": "25.1", "results": [ { "additional_locations": [ "Golgi apparatus" ], "description": "Major histocompatibility complex, class II, DQ beta 1", "ensembl_gene_id": "ENSG00000179344", "gene": "HLA-DQB1", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Supported", "status": "main" }, "main_locations": [ "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000179344", "subcellular_reliability": "Supported", "uniprot_accessions": [] }, { "additional_locations": [], "description": "ADP-ribosyltransferase 4 (inactive) (Dombrock blood group)", "ensembl_gene_id": "ENSG00000111339", "gene": "ART4", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000111339", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q93070" ] }, { "additional_locations": [], "description": "Novel protein", "ensembl_gene_id": "ENSG00000290315", "gene": "ENSG00000290315", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Nucleoplasm", "Cytosol", "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000290315", "subcellular_reliability": "Approved", "uniprot_accessions": [] }, { "additional_locations": [], "description": "Inosine monophosphate dehydrogenase 1", "ensembl_gene_id": "ENSG00000106348", "gene": "IMPDH1", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Cytosol", "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000106348", "subcellular_reliability": "Supported", "uniprot_accessions": [ "P20839" ] }, { "additional_locations": [], "description": "ISL LIM homeobox 2", "ensembl_gene_id": "ENSG00000159556", "gene": "ISL2", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000159556", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q96A47" ] }, { "additional_locations": [], "description": "Serine/threonine kinase 3", "ensembl_gene_id": "ENSG00000104375", "gene": "STK3", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Intermediate filaments", "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000104375", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q13188" ] }, { "additional_locations": [], "description": "Ubiquitin protein ligase E3D", "ensembl_gene_id": "ENSG00000118420", "gene": "UBE3D", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "main" }, "main_locations": [ "Rods & Rings" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000118420", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q7Z6J8" ] }, { "additional_locations": [ "Vesicles", "Rods & Rings" ], "description": "Adenylate cyclase 7", "ensembl_gene_id": "ENSG00000121281", "gene": "ADCY7", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Plasma membrane" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000121281", "subcellular_reliability": "Approved", "uniprot_accessions": [ "P51828" ] }, { "additional_locations": [ "Rods & Rings" ], "description": "1-acylglycerol-3-phosphate O-acyltransferase 1", "ensembl_gene_id": "ENSG00000204310", "gene": "AGPAT1", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Endoplasmic reticulum" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000204310", "subcellular_reliability": "Supported", "uniprot_accessions": [ "Q99943" ] }, { "additional_locations": [ "Golgi apparatus", "Rods & Rings" ], "description": "Glycerate kinase", "ensembl_gene_id": "ENSG00000168237", "gene": "GLYCTK", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Cytosol" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000168237", "subcellular_reliability": "Supported", "uniprot_accessions": [ "Q8IVS8" ] }, { "additional_locations": [ "Centrosome", "Rods & Rings" ], "description": "G protein subunit beta 5", "ensembl_gene_id": "ENSG00000069966", "gene": "GNB5", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Nuclear speckles" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000069966", "subcellular_reliability": "Approved", "uniprot_accessions": [ "O14775" ] }, { "additional_locations": [ "Rods & Rings" ], "description": "Inosine monophosphate dehydrogenase 2", "ensembl_gene_id": "ENSG00000178035", "gene": "IMPDH2", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Cytosol" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000178035", "subcellular_reliability": "Supported", "uniprot_accessions": [ "P12268" ] }, { "additional_locations": [ "Rods & Rings" ], "description": "Integrin subunit beta 2", "ensembl_gene_id": "ENSG00000160255", "gene": "ITGB2", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Plasma membrane" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000160255", "subcellular_reliability": "Supported", "uniprot_accessions": [ "P05107" ] }, { "additional_locations": [ "Lysosomes", "Rods & Rings" ], "description": "Scavenger receptor class B member 1", "ensembl_gene_id": "ENSG00000073060", "gene": "SCARB1", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Vesicles" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000073060", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q8WTV0" ] }, { "additional_locations": [ "Nucleoplasm", "Rods & Rings" ], "description": "Scribble planar cell polarity protein", "ensembl_gene_id": "ENSG00000180900", "gene": "SCRIB", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Plasma membrane", "Cell Junctions" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000180900", "subcellular_reliability": "Enhanced", "uniprot_accessions": [ "Q14160" ] }, { "additional_locations": [ "Rods & Rings" ], "description": "Zinc finger protein 211", "ensembl_gene_id": "ENSG00000121417", "gene": "ZNF211", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Mitochondria" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000121417", "subcellular_reliability": "Approved", "uniprot_accessions": [ "Q13398" ] }, { "additional_locations": [ "Nucleoplasm", "Rods & Rings" ], "description": "Zinc finger protein 266", "ensembl_gene_id": "ENSG00000174652", "gene": "ZNF266", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Approved", "status": "additional" }, "main_locations": [ "Vesicles" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000174652", "subcellular_reliability": "Supported", "uniprot_accessions": [ "Q14584" ] }, { "additional_locations": [ "Nucleoli", "Rods & Rings" ], "description": "Lin-28 homolog A", "ensembl_gene_id": "ENSG00000131914", "gene": "LIN28A", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Uncertain", "status": "additional" }, "main_locations": [ "Cytosol" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000131914", "subcellular_reliability": "Supported", "uniprot_accessions": [ "Q9H9Z2" ] }, { "additional_locations": [ "Rods & Rings" ], "description": "Store-operated calcium entry associated regulatory factor", "ensembl_gene_id": "ENSG00000133872", "gene": "SARAF", "location": { "go_id": null, "name": "Rods & Rings", "reliability": "Uncertain", "status": "additional" }, "main_locations": [ "Endoplasmic reticulum" ], "rna_single_cell_type": null, "rna_tissue": null, "source_url": "https://v25.proteinatlas.org/ENSG00000133872", "subcellular_reliability": "Supported", "uniprot_accessions": [ "Q96BY9" ] } ], "source_url": "https://v25.proteinatlas.org/search/subcell_location:Rods%20%26%20Rings", "total_count": 19 } ``` ### Antibodies - Capability: `antibodies/antibodies` - Description: The antibodies the Human Protein Atlas used for one gene, by gene symbol or synonym, Ensembl gene ID, UniProt accession or proteinatlas.org URL: antibody ID, providers with product links, product name, host species, clonality, the HPA release it first appeared in, publication count, antigen sequence, and the validation grade for each application (immunocytochemistry, immunohistochemistry, western blot, protein array) with the method behind Enhanced (genetic, orthogonal, independent, recombinant). A gene without antibodies has an empty list; an unknown gene is not_found. - Instructions: Choose or check a reagent: which antibodies exist for a protein, who sells them and how well HPA validated each for IF, IHC or western blot. - Cost: 5 credits per call - Capability file: [Antibodies](https://firecrawl.dev/alexandria/agents/providers/proteinatlas-org/antibodies/antibodies) Accepted options: - `gene` (string): Gene symbol or synonym (TP53, p53, FAM46C), Ensembl gene ID (ENSG00000141510; a .version is ignored) or UniProt accession (P04637). Pass this or url. Example: `` - `url` (string): A proteinatlas.org gene page URL, e.g. https://www.proteinatlas.org/ENSG00000141510-TP53/subcellular. Example: `` Response schema example: ```json { "antibodies": [ { "antigen_sequence": "KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR", "clonality": "polyclonal", "host_species": "Rabbit", "id": "HPA051244", "product_name": "HPA051244", "providers": [ { "name": "Atlas Antibodies", "url": "https://www.atlasantibodies.com/products/HPA051244" }, { "name": "Sigma-Aldrich", "url": "https://www.sigmaaldrich.com/product/sigma/HPA051244" } ], "reference_count": 0, "released_in_version": "12.0", "validation": { "icc": { "grade": "Enhanced", "method": "Genetic" }, "ihc": null, "pa": { "grade": "Supported", "method": null }, "wb": { "grade": "Enhanced", "method": "Orthogonal" } } }, { "antigen_sequence": "QSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAP", "clonality": "polyclonal", "host_species": "Rabbit", "id": "HPA063532", "product_name": "HPA063532", "providers": [ { "name": "Atlas Antibodies", "url": "https://www.atlasantibodies.com/products/HPA063532" }, { "name": "Sigma-Aldrich", "url": "https://www.sigmaaldrich.com/product/sigma/HPA063532" } ], "reference_count": 0, "released_in_version": "19.0", "validation": { "icc": { "grade": "Supported", "method": null }, "ihc": null, "pa": { "grade": "Approved", "method": null }, "wb": { "grade": "Uncertain", "method": null } } }, { "antigen_sequence": null, "clonality": "monoclonal", "host_species": "Mouse", "id": "CAB002973", "product_name": "M7001", "providers": [ { "name": "Agilent (Formerly DakoCytomation)", "url": "http://www.agilent.com" } ], "reference_count": 0, "released_in_version": "1.2", "validation": { "icc": null, "ihc": { "grade": "Enhanced", "method": "Orthogonal" }, "pa": null, "wb": { "grade": "Supported", "method": null } } }, { "antigen_sequence": null, "clonality": "monoclonal", "host_species": "Mouse", "id": "CAB039238", "product_name": "MS-187", "providers": [ { "name": "Thermo Fisher Scientific (Formerly Lab Vision/NeoMarkers)", "url": "http://www.thermofisher.com" } ], "reference_count": 0, "released_in_version": "7.0", "validation": { "icc": { "grade": "Supported", "method": null }, "ihc": { "grade": "Enhanced", "method": "Orthogonal" }, "pa": null, "wb": { "grade": "Supported", "method": null } } }, { "antigen_sequence": null, "clonality": "monoclonal", "host_species": "Mouse", "id": "CAB039239", "product_name": "MS-104", "providers": [ { "name": "Thermo Fisher Scientific (Formerly Lab Vision/NeoMarkers)", "url": "http://www.thermofisher.com" } ], "reference_count": 0, "released_in_version": "7.0", "validation": { "icc": { "grade": "Supported", "method": null }, "ihc": { "grade": "Enhanced", "method": "Orthogonal" }, "pa": null, "wb": { "grade": "Uncertain", "method": null } } }, { "antigen_sequence": null, "clonality": "monoclonal", "host_species": "Mouse", "id": "CAB072876", "product_name": "AMAb90956", "providers": [ { "name": "Atlas Antibodies", "url": "https://www.atlasantibodies.com/products/primary-antibodies/precisa-monoclonals/anti-tp53-antibody-amab90956/" } ], "reference_count": 1, "released_in_version": "14.0", "validation": { "icc": null, "ihc": { "grade": "Enhanced", "method": "Orthogonal" }, "pa": null, "wb": { "grade": "Uncertain", "method": null } } } ], "antibody_count": 6, "ensembl_gene_id": "ENSG00000141510", "gene": "TP53", "license": { "attribution": "Human Protein Atlas (proteinatlas.org) version 25.1, licensed under CC BY 4.0. Data available from https://v25.proteinatlas.org/ENSG00000141510/summary/antibody. Cite Uhlén M et al., Tissue-based map of the human proteome, Science 2015 (doi:10.1126/science.1260419).", "name": "CC BY 4.0", "url": "https://creativecommons.org/licenses/by/4.0/" }, "matched_on": "gene_name", "observed_at_ms": 1792530444665, "release": "25.1", "source_url": "https://v25.proteinatlas.org/ENSG00000141510/summary/antibody", "uniprot_accessions": [ "P04637" ] } ```